2.50 Rating by CuteStat

idealjunglesafaris.com is 1 decade 9 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, idealjunglesafaris.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: 26
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 2,100
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: 6 H4 Headings: 7
H5 Headings: 7 H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 21
Google Adsense: Not Applicable Google Analytics: UA-36251023-1

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 12 Dec 2019 10:30:58 GMT
Server: Apache
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 10631
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Aug 6, 2013, 11:39 PM 1 decade 9 months 4 days ago
Expiration Date: Aug 6, 2021, 11:39 PM 2 years 9 months 1 week ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns6489.hostgator.com 192.254.234.252 United States of America United States of America
ns6490.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
idealjunglesafaris.com A 10800 IP: 192.254.234.33
idealjunglesafaris.com NS 86400 Target: ns6490.hostgator.com
idealjunglesafaris.com NS 86400 Target: ns6489.hostgator.com
idealjunglesafaris.com SOA 10800 MNAME: ns6489.hostgator.com
RNAME: dnsadmin.gator3245.hostgator.com
Serial: 2019110400
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
idealjunglesafaris.com MX 14400 Target: idealjunglesafaris.com
idealjunglesafaris.com TXT 14400 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: IDEALJUNGLESAFARIS.COM
Registry Domain ID: 1820181277_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-08-21T08:20:31Z
Creation Date: 2013-08-06T17:54:36Z
Registrar Registration Expiration Date: 2021-08-06T17:54:36Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization:
Registrant State/Province: Maharashtra
Registrant Country: IN
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=IDEALJUNGLESAFARIS.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=IDEALJUNGLESAFARIS.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=IDEALJUNGLESAFARIS.COM
Name Server: NS6489.HOSTGATOR.COM
Name Server: NS6490.HOSTGATOR.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-12T10:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.